thiol raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-10-05. Anything still debated is marked as such rather than presented as settled.
Enzymatic recycling assays provide a complementary approach for total glutathione. In these methods, glutathione reductase reduces oxidized glutathione while a thiol-reactive reagent, such as 5,5'-dithiobis(2-nitrobenzoic acid), produces a colored product. The reaction cycles between reduced and oxidized forms, amplifying the signal. Spectrophotometric or fluorometric detection can then estimate concentration. Distinguishing reduced glutathione from glutathione disulfide often requires separate aliquots, masking agents, or chromatographic separation, and the choice affects reported values.
Storage conditions strongly influence glutathione stability. The solid reduced form is commonly kept desiccated at or below minus twenty degrees Celsius, protected from light and moisture. Aqueous solutions are less stable because the thiol group reacts with dissolved oxygen, and oxidation accelerates at neutral or alkaline pH. Acidic solutions and oxygen-free handling can slow degradation, but repeated freeze-thaw cycles should be avoided. Researchers often verify concentration before use, because apparent losses can arise from oxidation or water uptake.
Glutathione supports several cellular processes beyond direct antioxidant action. It serves as a cofactor for glutathione peroxidase and glutathione S-transferase enzymes, which reduce peroxides and conjugate electrophiles, respectively. The molecule also acts as a reservoir of cysteine, an amino acid that can limit protein synthesis and redox signaling. In human nutrition, oral glutathione is sold as a supplement, but how much intact glutathione reaches tissues after ingestion remains an active research question. Clinical claims about supplementation are not uniformly supported by controlled trials.
Glutathione is a small tripeptide built from glutamic acid, cysteine, and glycine. Its peptide bond between glutamate and cysteine involves the gamma-carboxyl group rather than the usual alpha-carboxyl group. This structure gives the molecule a reactive thiol on the cysteine residue. The reduced form, often abbreviated GSH, is the predominant intracellular species in many cell types. Because the thiol can donate electrons, glutathione participates in redox chemistry and in the conjugation of reactive molecules.
Cells synthesize glutathione through two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine, and glutathione synthetase adds glycine to form the complete tripeptide. Breakdown occurs through gamma-glutamyl transpeptidase and subsequent peptidase reactions, forming the gamma-glutamyl cycle. Within cells, glutathione also forms a disulfide-linked dimer called GSSG when two GSH molecules react. The balance between GSH and GSSG is widely used as an indicator of oxidative conditions, although the ratio can vary by compartment and tissue.
| Property | Value | Notes |
|---|---|---|
| Solid storage temperature | -20 °C | Desiccated, protected from light |
| Solution stability | Hours to days at neutral pH | Acidic pH and low oxygen slow oxidation |
| Oxidized form | Glutathione disulfide (GSSG) | Formed by thiol oxidation |
| Typical analytical method | LC-MS/MS or enzymatic recycling | Choice depends on matrix and specificity |
| Thiol pKa | Approximately 9.2 | Influences reactivity at physiological pH |
For solid glutathione reagents, storage at low temperature and protection from moisture and light are typical precautions. Aqueous solutions can oxidize over time, and pH affects stability; alkaline conditions generally promote thiol oxidation. Some protocols prepare fresh solutions, while others use antioxidants or chelators to limit metal-catalyzed oxidation. Purity and counterion content can vary among commercial preparations, affecting concentration calculations. Certificates of analysis and validated assays help verify identity and purity.
Measuring glutathione in biological samples requires attention to oxidation, because GSH can convert to GSSG after sample collection. Blood and plasma samples are often treated with acid or alkylating agents to preserve the reduced form. Without stabilization, apparent GSH concentrations can fall while GSSG rises. Differences in sample type, handling delay, and deproteinization method can produce results that are not comparable across studies. Reporting preanalytical details is therefore important for interpreting findings.
Glutathione is present in most tissues, with especially high concentrations in the liver. It also serves as a cofactor for some enzymes and helps transport amino acids across cell membranes. In plants and microorganisms, glutathione contributes to stress responses and metal handling. The molecule is synthesized in two ATP-dependent steps, first producing gamma-glutamylcysteine and then adding glycine. Because cysteine availability often limits synthesis, dietary and metabolic factors can influence glutathione levels. Research continues to examine how these levels relate to health and disease.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. The peptide bond between glutamate and cysteine uses the gamma-carboxyl group of glutamate rather than the alpha-carboxyl group. This unusual linkage protects the molecule from many common peptidases. The cysteine side chain carries a thiol group that can undergo reversible oxidation. Because of this thiol, glutathione participates in redox reactions and helps maintain the reducing environment inside most cells in living systems.
In cells, glutathione exists mainly in a reduced form called GSH. When two GSH molecules react, they form oxidized glutathione, or GSSG, which contains a disulfide bond. The ratio of GSH to GSSG is often used as an indicator of oxidative stress. Enzymes such as glutathione peroxidase and glutathione reductase help cycle the molecule between these two states. This cycling supports antioxidant defense, detoxification of reactive molecules, and regulation of certain signaling pathways.
It is suggested that SNX8 participates in the development of the embryonic cardiac tissue since the gene is expressed with cells within the area of heart. This hypothesis is supported by the fact that SNX8 activity has been associated to sortin nexin L, a protein of the same family encoded by the SNX21 gene, which plays a role in the development of the embryonic liver. Deletions of chromosome 7p22 that induce happloinsufficiency of SNX8 among other genes (FTSJ2, NUDTI and MAD1L1) seem to cause craniosynostosis, dysmorphic features and cardiac malformations encompassing tetralogy of Fallot, one of the most common cyanotic congenital heart defects. Nevertheless, evidence demonstrates the existence of patients with SNX8 deletion whose cardiac tissue development does not experience any alteration. Finally, although cardiac malformation requires SNX8 haploinsufficiency, its deletion is not enough to cause this malformations on its own. ==== Relationship between cardiac malformations and cholesterol regulation ====
Oparin was born in Uglich in 1894 into a merchant family. He and his parents soon moved to Kokayevo, a nearby village. Oparin had an older brother, Dmitry, who became an economist. Oparin graduated from the Moscow State University in 1917 and became a professor of biochemistry there in 1927. Many of his early papers were about plant enzymes and their role in metabolism. His first experimental studies were devoted to the chemistry of respiration. In them, he showed that chlorogenic acid is an essential component of redox reactions in the cell. In 1924 he put forward a hypothesis suggesting that life on Earth developed through a gradual chemical evolution of carbon-based molecules in the Earth's primordial soup. In 1935, along with academician Aleksei Bach, he founded the Biochemistry Institute of the Soviet Academy of Sciences. In 1939, Oparin became a Corresponding Member of the Academy, and, in 1946, a full member. In 1937, he organized the Department of Technical Biochemistry at the Moscow Technological Institute of Food Industry. In 1940s and 1950s, Oparin supported the theories of Trofim Lysenko and Olga Lepeshinskaya, who made claims about "the origin of cells from noncellular matter". "Taking the party line" helped advance his career. However, according to cytologist Vladimir Alexandrov:
Although it is a relatively immature area of research, it appears that heterotrimeric G-proteins may also take part in non-GPCR signaling. There is evidence for roles as signal transducers in nearly all other types of receptor-mediated signaling, including integrins, receptor tyrosine kinases (RTKs), cytokine receptors (JAK/STATs), as well as modulation of various other "accessory" proteins such as GEFs, guanine-nucleotide dissociation inhibitors (GDIs) and protein phosphatases. There may even be specific proteins of these classes whose primary function is as part of GPCR-independent pathways, termed activators of G-protein signalling (AGS). Both the ubiquity of these interactions and the importance of Gα vs. Gβγ subunits to these processes are still unclear. There are two principal signal transduction pathways involving the G protein-linked receptors: the cAMP signal pathway and the phosphatidylinositol signal pathway.
Benninghoven graduated from the University of Cologne in 1961 where he worked with Fritz Kirchner (1896–1967) and completed his habilitation in surface physics in Cologne two years later. He first worked as professor in Cologne from 1965 to 1973 until he moved to a full professor position in experimental physics at the University of Münster in 1972. He worked on static secondary ion mass spectrometry (SIMS) and its applications, and developed SIMS instruments. In 1989 he co-founded IonTOF, a company that became a world-leader in TOF-SIMS instrumentation. He has written over 300 scientific articles and several books on the topic of SIMS, many of which have become reference works on SIMS. For his work, he has received the Technology Transfer prize (German Ministry of Education and Research) and the 1984 Gaede-Langmuir Prize (American Vacuum Society) for the development of concepts and instrumentation in static secondary ion mass spectrometry and the demonstration of its usefulness in manifold applications. In 1990 he shared the Fritz-Pregl-Medaille of the Austrian Society of Analytical Chemistry with Wilhelm Simon. From 1977 to 1983, he was president of the German Vacuum Society (part of the German Physical Society).
Aspartic acid was first discovered in 1827 by Auguste-Arthur Plisson and Étienne-Ossian Henry by hydrolysis of asparagine, which had been isolated from asparagus juice in 1806. Their original method used lead hydroxide, but various other acids or bases are now more commonly used instead. There are two forms or enantiomers of aspartic acid. The name "aspartic acid" can refer to either enantiomer or a mixture of two. Of these two forms, only one, "L-aspartic acid", is directly incorporated into proteins. The biological roles of its counterpart, "D-aspartic acid" are more limited. Where enzymatic synthesis will produce one or the other, most chemical syntheses will produce both forms, "DL-aspartic acid", known as a racemic mixture. In the human body, aspartate is most frequently synthesized through the transamination of oxaloacetate. The biosynthesis of aspartate is facilitated by an aminotransferase enzyme: the transfer of an amine group from another molecule such as alanine or glutamine yields aspartate and an alpha-keto acid.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
In jaundice owing to hemolysis (prehepatic, or hemolytic, jaundice), the pathophysiology is that overproduction of bilirubin from the extravascular or intravascular hemolysis overwhelms the capacity of the liver to excrete it. The bilirubin present in the plasma is largely unconjugated in this setting as they haven't been taken up and conjugated by the liver. In this case, total serum bilirubin increases while the ratio of direct bilirubin to indirect bilirubin remains 96 to 4 as up to 96%-99% of bilirubin in the bile are conjugated mentioned above. Although there were some studies that showed an inverse correlation between serum bilirubin level and prevalences of ischemic coronary artery disease, cancer mortality, or colorectal cancer in general population, the potential benefits of the chemopreventive function of bilirubin and their causative relations haven't been proved.
CCL7 was first characterized from osteosarcoma supernatant. CCL7 consists of 99 amino acids, which contains 23-amino acid signal peptide. The mature protein about 76 amino acids is secreted after cleavage of the signal peptide. In contrast to most chemokines, CCL7 exists in a general monomeric form, differing from the dimer formed in a highly concentrated solution. CCL7 can exist in four different glycotypes with a molecular weight 11, 13, 17 and 18 kDa in COS cells. CCL7 mediates effects on the immune cell types through binding to numerous receptors, including CCR1, CCR2, CCR3, CCR5, and CCR10. These receptors belongs to the G protein-coupled seven-transmembrane receptors. CCL7 can also interact with cell surface glycosaminoglycans (GAGs) present on all animal cell surfaces.
100. Tirzepatide. Drugs and Lactation Database (LactMed®) [Internet]. Bethesda (MD): National Institute of Child Health and Human Development; 2006–. 2026 Aug 15. Tirzepatide is usually undetectable in breastmilk with subcutaneous doses of up to 5 mg. Furthermore, absorption by the infant is unlikely because it is probably partially destroyed in the infant’s gastrointestinal tract and poorly absorbed orally. If a mother requires tirzepatide, it is not a reason to discontinue breastfeeding. Until more data become available, tirzepatide should be used with caution during breastfeeding, especially while nursing a newborn or preterm infant. Some experts recommend closely monitoring of infant growth and developmental milestones and the nutritional status of the lactating woman.[1]
ASQ offers 18 professional certifications relating to various aspects of the quality profession. Professional certification exams are translated into five languages included English, Korean, Mandarin, Portuguese, and Spanish. Exams are given nationally and, to a limited degree, worldwide several times annually. The body of knowledge for each certification is maintained through peer review every few years on a rotating schedule. In 1968, the first ASQ certification was offered. In 2016, ASQ's certification exam delivery method changed from paper to computer-based testing at Prometric nationwide testing facilities. ASQ publishes a range of magazines and journals: Quality Progress Journal for Quality and Participation Journal of Quality Technology Quality Engineering Quality Management Journal Lean & Six Sigma Review Software Quality Professional Technometrics Journal for Quality Perspectives in Knowledge Acquisition Quality Management Forum Primers on Human Development and Leadership ASQ hosts a number of quality events and annual conferences worldwide:
Sources: en.wikipedia.org
N-acylneuraminate cytidylyltransferase is an enzyme that in humans is encoded by the CMAS gene. The enzyme encoded by this gene catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus. Human CMAS genome location and CMAS gene details page in the UCSC Genome Browser.
Once active, Akt translocates from the plasma membrane to the cytosol and nucleus, where many of its substrates reside. Akt regulates a wide range of proteins by phosphorylation. Akt target substrates contain a minimum consensus sequence R-X-R-X-X-[Ser/Thr]-Hyd, where Hyd is a hydrophobic amino acid, although other factors such as sub-cellular localisation and 3-dimensional structure are important. Phosphorylation by Akt can be inhibitory or stimulatory, either suppressing or enhancing the activity of target proteins.
Carnitine is an essential cofactor for mitochondrial transport of long‑chain fatty acids (a major lipid class) into the matrix for β‑oxidation. gamma-aminobutyric acid is a neurotransmitter. 5-HTP (5-hydroxytryptophan) is used for experimental treatment of depression. L-DOPA (L-dihydroxyphenylalanine) for Parkinson's treatment, Eflornithine inhibits ornithine decarboxylase and used in the treatment of sleeping sickness. Canavanine, an analogue of arginine found in many legumes is an antifeedant, protecting the plant from predators. Mimosine found in some legumes, is another possible antifeedant. This compound is an analogue of tyrosine and can poison animals that graze on these plants. However, not all of the functions of other abundant nonstandard amino acids are known.
The cytoskeleton is found underlying the cell membrane in the cytoplasm and provides a scaffolding for membrane proteins to anchor to, as well as forming organelles that extend from the cell. Indeed, cytoskeletal elements interact extensively and intimately with the cell membrane. Anchoring proteins restricts them to a particular cell surface—for example, the apical surface of epithelial cells that line the vertebrate gut—and limits how far they may diffuse within the bilayer. The cytoskeleton is able to form appendage-like organelles, such as cilia, which are microtubule-based extensions covered by the cell membrane, and filopodia, which are actin-based extensions. These extensions are ensheathed in membrane and project from the surface of the cell in order to sense the external environment and/or make contact with the substrate or other cells. The apical surfaces of epithelial cells are dense with actin-based finger-like projections known as microvilli, which increase cell surface area and thereby increase the absorption rate of nutrients. Localized decoupling of the cytoskeleton and cell membrane results in formation of a bleb.
Desiccation (drought) stress is defined as conditions where water becomes the growth limiting factor. MAAs have been reportedly found in high concentrations in many microorganisms exposed to drought stress. Particularly cyanobacteria species that are exposed to desiccation, UV radiation and oxidation stress have been shown to possess MAA's in an extracellular matrix. However it has been shown that MAAs do not provide sufficient protection against high doses of UV radiation. Thermal (heat) stress is defined as temperatures lethal or inhibitory towards growth. MAA concentrations have been shown to be up-regulated when an organism is under thermal stress. Multipurpose MAAs could also be compatible solutes under freezing conditions, because a high incidence of MAA producing organisms have been reported in cold aquatic environments.
Sources: en.wikipedia.org
Chromatographic methods can separate the two forms before detection. Enzymatic assays often measure total glutathione first and then use a separate procedure to estimate the oxidized fraction. The difference between total and oxidized amounts provides an indirect estimate of the reduced form.
Acidification lowers pH and slows thiol oxidation during handling. It also helps precipitate proteins that could interfere with detection. Typical choices include metaphosphoric acid and sulfosalicylic acid.
Dissolved oxygen reacts with the thiol group, forming glutathione disulfide. Neutral and alkaline conditions generally increase the oxidation rate. Light, metal ions, and repeated freezing and thawing can also reduce stability.
It is a tripeptide of glutamic acid, cysteine, and glycine. The linkage between glutamate and cysteine uses the gamma-carboxyl group, which is unusual for peptides.